Analytical Data
-
Gene name
IL-17RB
-
简介
IL-17RB (Interleukin 17 receptor B), a protein encoded by the IL17RB gene, is a receptor for the pro-inflammatory cytokines IL17B and IL17E. IL-17RB expression is high in kidney, pancreas, liver, brain, and intestines. IL-17RB may play a role in hematopoietic cell differentiation and growth. IL-17RB is involved in inflammatory diseases and cancers[1][2]. IL-17RB Protein, Rhesus Macaque (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag.
- Application
-
Biological Activity
Immobilized Recombinant Human IL-17E at 0.5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Rhesus IL-17RB. The ED50 for this effect is 11.07 ng/mL. Immobilized Recombinant Human IL-17E at 0.5 μg/ml (100 μL/well) can bind Biotinylated Recombinant Rhesus IL-17RB. The ED50 for this effect is 11.07 ng/mL.
-
Alternative Names
Interleukin-17 receptor B; IL-17RB; IL-17Rh1; IL-17B receptor; CRL4; EVI27
-
Species
Rhesus Macaque
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE. as determined by SDS-PAGE.
-
Uniprot
G7ML21
-
Expression Region
R18-G288
-
AA Sequence
REPTVQCGSETGPSPEWMLQHDLTPGDLRDLRVEPVKTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSLNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTSPLGNRYMALIQHSTIIGFSQVSEPYQNKQTRASVVIPVTEESEGAMVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNRSKPG
-
Protein Length
Partial
-
Molecular Weight
40-50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Related Products
Protein Description
Interleukin-17 receptor B (IL-17RB) plays a crucial role in the immune response, particularly in defense against various pathogens and in the pathogenesis of inflammatory diseases. Discovered as a receptor for IL-25 (also known as IL-17E), IL-17RB is predominantly expressed in epithelial cells and immune cells, indicating its significant function in mucosal immunity. Its activation triggers downstream signaling pathways, leading to the production of pro-inflammatory cytokines, growth factors, and chemokines, which are vital for recruiting eosinophils and other inflammatory cells to sites of inflammation. Given its central role in mediating Th2-type immune responses, IL-17RB has emerged as a potential therapeutic target for allergic diseases, asthma, and other Th2-mediated conditions. Recent studies have also highlighted its involvement in various cancers, making it a candidate for further research in tumor immunology. The development of recombinant IL-17RB proteins aims to better understand its biological functions and therapeutic potential by enabling researchers to explore its signaling mechanisms, binding affinities, and interactions with other immune modulators. These advancements could pave the way for innovative treatments for IL-17RB-related diseases and enhance our understanding of its role in both protective immunity and pathological inflammation.











