Recombinant Rhesus Macaque OX40/TNFRSF4 Protein(HEK293) , His

OX40/TNFRSF4

OX40 (TNFRSF4), is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells. OX40 can be activated by OX40 Ligand, thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40/TNFRSF4 Protein, Rhesus Macaque (HEK293, Fc) is a recombinant rhesus macaque OX40 (M1-A216) with C-terminal His tag, which is produced in HEK293.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured by its binding ability in a functional ELISA. When Recombinant Rhesus Macaque OX40 is immobilized at 2 μg/mL (100 μL/well), the concentration of Human OX40 Ligand that produces 50% of the optimal binding response is found to be approximately 1.369 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Rhesus Macaque OX40 is immobilized at 2 μg/mL (100 μL/well), the concentration of Human OX40 Ligand that produces 50% of the optimal binding response is found to be approximately 1.369 ng/mL.

Tumor necrosis factor receptor superfamily member 4; TNFRSF4; OX40; CD134; Txgp1

Rhesus Macaque

HEK293

C-6*His

Greater than 95% as determined by reducing SDS-PAGE.

XP_001090870.1

K28-A216

KLHCVGDTYPSNDRCCQECRPGNGMVSRCNRSQNTVCRPCGPGFYNDVVSAKPCKACTWCNLRSGSERKQPCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPPTQPQETQGPPARPTTVQPTEAWPRTSQRPSTRPVEVPRGPAVA

Partial

30-45 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.