Cat: IPD-X17729

Recombinant Mouse RANKL/TNFSF11 Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RANKL/TNFSF11

  • 简介

    RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANK L/TNFSF11 Protein, Mouse (HEK293, C-His) is a recombinant mouse RANKL (R72-D316) with N-terminal 6*His tag, which is produced in HEK293[1][2].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rMuRANK L/TNFSF11, His; TRANCE; CD254

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    N-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    O35235-1

  • Expression Region

    R72-D316

  • AA Sequence

    RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    32-35 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RANKL (Receptor Activator of Nuclear Factor κB Ligand), also known as TNFSF11 (Tumor Necrosis Factor Superfamily Member 11), plays a crucial role in bone metabolism and immune response. It is a cytokine that primarily regulates osteoclastogenesis—the process by which bone-resorbing osteoclasts are formed from precursor cells. The interaction of RANKL with its receptor RANK, found on osteoclast precursors, is fundamental for the differentiation, activation, and survival of osteoclasts, which are essential for bone remodeling. Dysregulation of the RANKL/RANK signaling pathway is implicated in various bone diseases, such as osteoporosis, rheumatoid arthritis, and bone metastasis. Research on recombinant RANKL protein has gained prominence as it provides vital insights into the molecular mechanisms of osteoclastogenesis and offers potential therapeutic avenues for treating bone-related disorders. Additionally, recombinant RANKL is used in in vitro studies to generate osteoclasts for research purposes, enhancing our understanding of bone biology and the pathophysiology of osteoclast-mediated diseases. The study of RANKL/TNFSF11 recombinant proteins could lead to innovative treatments that target RANKL signaling, potentially ameliorating conditions characterized by excessive bone loss or insufficient bone remodeling. As research progresses, elucidating the structure-function relationships, regulatory mechanisms, and therapeutic implications of RANKL will be pivotal in developing effective strategies for managing bone-related illnesses and improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US