Analytical Data
-
Gene name
PD-L1
-
简介
PD-L1 (Programmed death-ligand 1) critically regulates T cell proliferation and migration, acting as a biomarker for periodontitis and pre-eclampsia. CD274 is its human ortholog. Biased expression in the thymus (RPKM 102.9), spleen (RPKM 58.3), and other tissues emphasizes PD-L1's centrality in immune regulation across diverse physiological and pathological conditions. PD-L1 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-L1 protein, expressed by HEK293 , with C-10*His labeled tag.
- Application
-
Biological Activity
1. Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is 0.1872 μg/ml in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 5.34×10^3 units/mg. 2. Measured by its binding ability in a functional ELISA. When Recombinant Rat PD-1 is present at 1 μg/mL, can bind Recombinant Rat PD-L1. The ED50 for this effect is 0.526 μg/mL. Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.1872 μg/mL in the presence of 10 μg/mL anti-CD3, corresponding to a specific activity is 5.34×103 units/mg.
-
Alternative Names
Programmed cell death 1 ligand 1; PD-L1; B7-H1; CD274; PDL1
-
Species
Rat
-
Source
HEK293
-
Tag
C-10*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
NP_001178883.1
-
Expression Region
A18-T238
-
AA Sequence
AFTITAPKDLYVVEYGSNVTMECRFPVEQKLDLLALVVYWEKEDKEVIQFVEGEEDLKPQHSSFRGRAFLPKDQLLKGNAVLQITDVKLQDAGVYCCMISYGGADYKRITLKVNAPYRKINQRISMDPATSEHELMCQAEGYPEAEVIWTNSDHQSLSGETTVTTSQTEEKLLNVTSVLRVNATANDVFHCTFWRVHSGENHTAELIIPELPVPRLPHNRT
-
Protein Length
Partial
-
Molecular Weight
41.79 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PD-L1 (Programmed Death-Ligand 1) is a critical immune checkpoint molecule that plays a significant role in regulating the immune response, particularly in the context of cancer. It is primarily expressed on the surface of tumor cells and interacts with the PD-1 receptor on T cells, leading to the inhibition of T cell activation and proliferation. This mechanism is often exploited by tumors to evade immune detection and destruction. Due to its pivotal role in immune regulation, PD-L1 has become a prominent target for cancer immunotherapy, with the development of monoclonal antibodies that block this interaction, thereby enhancing anti-tumor immunity. Research on recombinant PD-L1 proteins has gained momentum as scientists seek to better understand its structure, function, and the dynamics of its interactions with other immune molecules. These studies provide insights into the potential therapeutic applications of PD-L1 inhibitors and the design of more effective immunotherapeutic strategies. Moreover, the production of recombinant PD-L1 proteins allows for detailed biochemical and biophysical characterizations, facilitating the identification of specific binding affinities and the delineation of signaling pathways involved in immune regulation. Overall, the continual exploration of PD-L1 and its role in the immune system underscores its importance in developing new cancer therapies aimed at reactivating the body’s own immune response against malignancies.
