Analytical Data
-
Gene name
PD-L1
-
简介
The PD-L1 protein critically regulates immune tolerance by acting as a ligand for PDCD1/PD-1, regulating T cell activation threshold, and limiting effector responses. It may act as a costimulatory molecule for IL10-producing T cell subsets. PD-L1 Protein, Human (HEK293) is the recombinant human-derived PD-L1 protein, expressed by HEK293 , with tag free.
- Application
-
Biological Activity
Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is ≤0.2111 μg/ml in the presence of 10 μg/mL anti-CD3. Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL‑2 mouse cytotoxic T cells. The ED50 for this effect is 0.2191 μg/mL in the presence of 10μg/mL anti-CD3, corresponding to a specific activity is 4.56×103 units/mg.
-
Alternative Names
Programmed cell death 1 ligand 1; PD-L1; B7-H1; CD274; PDL1
-
Species
Human
-
Source
HEK293
-
Tag
Tag Free
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
Q9NZQ7-1
-
Expression Region
F19-R238
-
AA Sequence
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
-
Protein Length
Extracellular Domain
-
Molecular Weight
31-38 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PD-L1 (Programmed Death-Ligand 1) is a critical immune checkpoint molecule that plays a significant role in regulating the immune response, particularly in the context of cancer. It is primarily expressed on the surface of tumor cells and interacts with the PD-1 receptor on T cells, leading to the inhibition of T cell activation and proliferation. This mechanism is often exploited by tumors to evade immune detection and destruction. Due to its pivotal role in immune regulation, PD-L1 has become a prominent target for cancer immunotherapy, with the development of monoclonal antibodies that block this interaction, thereby enhancing anti-tumor immunity. Research on recombinant PD-L1 proteins has gained momentum as scientists seek to better understand its structure, function, and the dynamics of its interactions with other immune molecules. These studies provide insights into the potential therapeutic applications of PD-L1 inhibitors and the design of more effective immunotherapeutic strategies. Moreover, the production of recombinant PD-L1 proteins allows for detailed biochemical and biophysical characterizations, facilitating the identification of specific binding affinities and the delineation of signaling pathways involved in immune regulation. Overall, the continual exploration of PD-L1 and its role in the immune system underscores its importance in developing new cancer therapies aimed at reactivating the body’s own immune response against malignancies.











