Cat: IPD-X16006

Recombinant Mouse FGFR-3 Protein(HEK293) , hFc & His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FGFR-3

  • 简介

    The FGFR-3 Protein is a member of the fibroblast growth factor receptor family. FGFR-3 Protein regulates chondrocyte differentiation and chondrocyte proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 mutations are also associated with sperm cell tumors. FGFR-3 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived FGFR-3 protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Fibroblast growth factor receptor 3; FGFR-3; CD333; JTK4

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-hFc;C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q7TSI8

  • Expression Region

    E21-Y367

  • AA Sequence

    MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVY

  • Protein Length

    Partial

  • Molecular Weight

    100-110 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fibroblast growth factor receptor 3 (FGFR-3) is a transmembrane protein that plays a critical role in regulating cell growth, differentiation, and apoptosis, particularly in bone and cartilage development. Mutations in the FGFR3 gene are associated with various skeletal disorders, most notably achondroplasia, the most common form of disproportionate dwarfism. Research into FGFR-3 recombinant proteins is pivotal for understanding its biological functions and the mechanisms underlying FGFR-3-related diseases. By producing recombinant FGFR-3 proteins, scientists can investigate the signaling pathways affected by its mutations and explore potential therapeutic targets for conditions resulting from FGFR-3 dysregulation. These studies also facilitate the development of drugs that could modulate FGFR-3 activity, offering hope for novel treatments for skeletal dysplasias and other FGFR-3 related anomalies. Furthermore, the recombinant protein serves as a valuable tool for structure-function analyses, enabling the identification of crucial domains for ligand interaction and receptor activation. Overall, FGFR-3 recombinant protein research is at the forefront of both congenital disorder investigations and the broader field of targeted molecular therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US