Analytical Data
-
Gene name
2B4/CD244
-
简介
2B4/CD244 protein exhibits heightened affinity for binding to CD48, surpassing isoform 1, leading to increased cytotoxicity and intracellular calcium release. The stronger interaction implies more robust engagement, potentially amplifying cellular responses, particularly heightened cytotoxic activity and intracellular calcium release. 2B4/CD244 Protein, Human (HEK293, His) is the recombinant human-derived 2B4/CD244 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Natural killer cell receptor 2B4; NAIL; NKR2B4; h2B4; SLAMF4; CD244; 2B4
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZW8-2
-
Expression Region
C22-R221
-
AA Sequence
CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR
-
Protein Length
Partial
-
Molecular Weight
35-60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The 2B4/CD244 protein is a significant member of the SLAM (signaling lymphocytic activation molecule) family, primarily recognized for its crucial role in regulating immune responses. This protein is predominantly expressed on natural killer (NK) cells and cytotoxic T lymphocytes, where it mediates cell activation, proliferation, and survival through interactions with its ligands, such as CD48. Research into 2B4/CD244 has gained momentum due to its implications in various physiological and pathological conditions, including immune regulation, cancer, and infectious diseases. Investigating 2B4/CD244 recombinant proteins allows researchers to delve into its structural and functional characteristics, thereby enhancing the understanding of immune cell signaling pathways. Moreover, 2B4/CD244 has emerged as a potential therapeutic target, with the prospect of developing monoclonal antibodies or engineered proteins to modulate immune responses in diseases like cancer or autoimmune disorders. Understanding the interactions and mechanisms of action of 2B4/CD244 can lead to novel strategies for immune modulation, making it a focal point in immunology research.











