Analytical Data
-
Gene name
LILRB1/CD85j/ILT2
-
简介
LILRB1/CD85j/ILT2 Protein is an inhibitory receptor broadly expressed on leukocytes and recognizes HLA-class I and human cytomegalovirus UL18[1]. LILRB1/CD85j/ILT2 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Biological Activity
Measured by its ability to inhibit proliferation of Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 0.9206 μg/ml, corresponding to a specific activity is 1.09×103 units/mg. Measured by its ability to inhibit proliferation of Jurkat human T-lymphocyte leukemia cells. The ED50 for this effect is 0.9206 μg/mL, corresponding to a specific activity is 1.09×103 units/mg.
-
Alternative Names
Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 1; LILRB1; CD85j; ILT2; LIR-1; MIR7
-
Species
Rhesus Macaque
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
F7H3G7
-
Expression Region
S17-H456
-
AA Sequence
SRTRVQAGTFPKPTLWAEPGSMISKGSPVTLRCQGSLPVQDYRLQREKKTASWVRRIQQELVKKGYFPIASITSEHAGQYRCQYYSHSWWSEPSDPLELVVTGAYSKPTLSALPSPVVASGGNVTLQCDSQVAGGFVLCKEGEDEHPQCLNSQPHTRGSSRAVFSVGPVSPSRRWSYRCYGYDSRSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGDKLTLQCGSDAGYNRFALYKEGERDFLQRPGRQPQAGLSQANFLLDPVRRSHGGQYRCSGAHNLSSEWSAPSDPLDILIAGQIRGRPSLLVQPGPTVVSGENVTLLCQSSWQFHVFLLTQAGAADAHLHLRSMYKYPKYQAEFPMSPVTSAHAGTYRCYGSHSSDSYLLSIPSDPLELVVSGPSGGPSSPTTGPTSTCGPEDQPLTPTGSDPQSGLGRH
-
Protein Length
Partial
-
Molecular Weight
60-85 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LILRB1, also known as CD85j or ILT2 (Immunoglobulin-like transcript 2), is a crucial immune checkpoint receptor belonging to the LILR (Leukocyte Immunoglobulin-like Receptor) family. It is primarily expressed on various immune cells, including monocytes, macrophages, and dendritic cells, where it plays a fundamental role in regulating immune responses. The receptor recognizes major histocompatibility complex (MHC) class I molecules, which allows it to modulate the activation and inhibition of immune cell functions. Due to its immunoregulatory capabilities, LILRB1 is considered a significant player in maintaining immune tolerance and preventing excessive inflammation, making it a potential target for therapeutic interventions in autoimmune diseases and cancer. The development of recombinant LILRB1/CD85j/ILT2 proteins enables researchers to explore its biological functions and interactions in detail, facilitating the understanding of its role in immune modulation. By studying these recombinant proteins, scientists aim to decipher the molecular mechanisms underlying LILRB1 signaling and its impact on immune cell behavior, paving the way for innovative treatments that leverage this checkpoint receptor in immunotherapy and transplant medicine. Overall, LILRB1’s unique properties and its emerging significance in immune regulation underscore the importance of continued research into its potential applications.











