Cat: IPD-X17426

Recombinant Human LILRB1/CD85j/ILT2 Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LILRB1/CD85j/ILT2

  • 简介

    The LILRB1/CD85j/ILT2 protein is a receptor for class I MHC antigens and recognizes multiple HLA alleles and H301/UL18 (human cytomegalovirus MHC homolog). Ligand binding induces inhibitory signals that downregulate immune responses. LILRB1/CD85j/ILT2 Protein, Human (435a.a, HEK293, His) is the recombinant human-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human LILRB1/CD85j/ILT2 (HY-P70179) at 2 μg/mL can bind Recombinant Human Angiopoietin-like Protein 7/ANGPTL7 (HY-P700852). The ED50 for this effect is 0.1069 μg/mL. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human LILRB1/CD85j/ILT2 (HY-P70179) at 2 μg/mL can bind Recombinant Human Angiopoietin-like Protein 7/ANGPTL7 (HY-P700852). The ED50 for this effect is 0.1069 μg/mL.

  • Alternative Names

    ILT2; ILT-2; ILT2FLJ37515; LILRB1; LIR1; MIR7; CD85J; XXbac-BCX85G21.4

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    ADJ55949.1

  • Expression Region

    G24-H458

  • AA Sequence

    GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRH

  • Protein Length

    Partial

  • Molecular Weight

    65-90 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LILRB1, also known as CD85j or ILT2 (Immunoglobulin-like transcript 2), is a crucial immune checkpoint receptor belonging to the LILR (Leukocyte Immunoglobulin-like Receptor) family. It is primarily expressed on various immune cells, including monocytes, macrophages, and dendritic cells, where it plays a fundamental role in regulating immune responses. The receptor recognizes major histocompatibility complex (MHC) class I molecules, which allows it to modulate the activation and inhibition of immune cell functions. Due to its immunoregulatory capabilities, LILRB1 is considered a significant player in maintaining immune tolerance and preventing excessive inflammation, making it a potential target for therapeutic interventions in autoimmune diseases and cancer. The development of recombinant LILRB1/CD85j/ILT2 proteins enables researchers to explore its biological functions and interactions in detail, facilitating the understanding of its role in immune modulation. By studying these recombinant proteins, scientists aim to decipher the molecular mechanisms underlying LILRB1 signaling and its impact on immune cell behavior, paving the way for innovative treatments that leverage this checkpoint receptor in immunotherapy and transplant medicine. Overall, LILRB1’s unique properties and its emerging significance in immune regulation underscore the importance of continued research into its potential applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US