Cat: IPD-X17376

Recombinant Human NKG2A Protein(HEK293) , His & Flag

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NKG2A

  • 简介

    The NKG2A protein is an important immunosuppressive receptor that forms a complex with KLRD1 on lymphocyte subsets for self-non-self discrimination. It recognizes HLA-E loaded with self-peptides, monitors MHC class I expression in healthy cells, and promotes self-tolerance. NKG2A-CD94 Heterodimer Protein, Human (HEK293, His-Flag) is a recombinant protein dimer complex containing human-derived NKG2A-CD94 Heterodimer protein, expressed by HEK293 , with N-Flag, N-8*His labeled tag. NKG2A-CD94 Heterodimer Protein, Human (HEK293, His-Flag), has molecular weight of 25-40 kDa.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NKG2A& CD94 Heterodimer; KLRC1& CD94 Heterodimer; CD159A& KLRD1 Heterodimer

  • Species

    Human

  • Source

    HEK293

  • Tag

    N-Flag;N-8*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P26715 (R100-L233)&Q13241

  • Expression Region

    P26715 (R100-L233)&Q13241 (S34-I179)

  • AA Sequence

    RHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL &: SFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI

  • Molecular Weight

    25-40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NKG2A is an inhibitory receptor primarily expressed on natural killer (NK) cells and some T cells, playing a crucial role in regulating immune responses. It interacts with its ligand, HLA-E, which presents peptides derived from major histocompatibility complex (MHC) class I molecules. This interaction is vital for maintaining immune tolerance and preventing autoimmunity. Research on NKG2A has gained traction due to its implications in cancer immunotherapy; tumors often exploit this pathway to evade immune detection by upregulating HLA-E expression, leading to decreased NK cell activity. Consequently, targeting NKG2A via monoclonal antibodies has emerged as a promising strategy in enhancing anti-tumor responses, making it a focal point in studies aimed at improving cancer treatment efficacy. Recent advancements in recombinant protein technology have facilitated the production of NKG2A-Fc fusion proteins, which can be used to block NKG2A’s inhibitory signals and restore NK cell function against malignancies. These innovations not only enhance our understanding of the immune evasion mechanisms employed by tumors but also pave the way for novel therapeutic interventions that can potentially improve patient outcomes in immuno-oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US