Cat: IPD-X17287

Recombinant Human IL-15R alpha & IL-15 Protein(HEK293) , hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-15R alpha & IL-15

  • 简介

    IL-15R alpha is a high affinity receptor for IL-15 (Kd: 100 pM). IL-15 is essential for the development and function natural killer (NK) cell, NKT cell and memory (m) CD8+ T cell[1]. IL-15R alpha maintains memory CD8+ T cell homeostasis and lymphocyte development. IL-15R alpha/IL-15 complex can activate the antitumor functions of NK cells and CD8+ T cells[2][3]. IL-15R alpha & IL-15 Protein, Human (HEK293, Fc) is a recombinant human IL-15R alpha (I31-D96) & IL-15 (N49-S162) fusion protein with a C-Terminal hFc tag, which is produced in HEK293 cells.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    1.The cell proliferation assay using CTLL-2 mouse cytotoxic T cells has an ED50 value of 5-20 ng/mL. 2. Measured in a cell proliferation assay using NK92 cells. The EDED50 for this effect is <0>2×106 units/mg. Measured in a cell proliferation assay using NK92 cells. The ED50 for this effect is 0.3326 ng/mL, corresponding to a specific activity is 3.007×106 units/mg.

  • Alternative Names

    IL15RA& IL15; Interleukin-15; IL-15; IL15; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin-15 receptor subunit alpha

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    Q13261-1 (I31-D96)&P40933-1

  • Expression Region

    Q13261-1 (I31-D96)&P40933-1 (N49-S162, N120D)

  • AA Sequence

    ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD&NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

  • Molecular Weight

    50-75 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-15 (IL-15) is a crucial cytokine involved in immune responses, particularly in the development, activation, and proliferation of natural killer (NK) cells and memory CD8+ T cells. The IL-15 receptor (IL-15R) is a complex system composed of three subunits: IL-15R alpha (IL-15Rα), IL-2R beta (IL-2Rβ), and common gamma chain (γc). Among these, IL-15Rα plays a significant role in the binding and presentation of IL-15 to its receptor complex, facilitating signaling pathways that promote cell survival and proliferation. Research on recombinant forms of IL-15, particularly those fused with IL-15Rα, has garnered attention due to their potential therapeutic applications in cancer immunotherapy and the treatment of immunodeficiencies. The combination of IL-15 with its receptor alpha enhances the stability, bioavailability, and specificity of IL-15, leading to improved immune responses. Studies have shown that recombinant IL-15 and IL-15Rα fusion proteins can enhance the proliferation and function of NK cells and CD8+ T cells, making them promising candidates for clinical applications. Understanding the molecular interactions of IL-15 and IL-15Rα is essential for optimizing these recombinant proteins and developing novel immunotherapeutic strategies. This area of research is crucial for advancing our knowledge of cytokine biology and harnessing the immune system to target various malignancies and infectious diseases effectively.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US