Cat: IPD-X17269

Recombinant Rat IL-2R gamma/CD132 Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-2R gamma/CD132

  • 简介

    IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2. IL-2R gamma takes part in inflammatory response and mediates activation of the cells [1][2]. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types[3]. IL-2R gamma/CD132 Protein, Rat (HEK293, His) is a recombinant rat extracellular region of IL-2R beta (M1-A262) with a C-Terminal His tag, which is produced in HEK293 cells.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to inhibit the IL-2-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED 50 for this effect is 0.8594 µg/mL, corresponding to a specific activity is 1163.603 units/mg in the presence of 5 µg/mL of soluble IL-2 R beta and 10 ng/mL of recombinant human IL-2. Measured by its ability to inhibit the IL-2-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 0.8594 µg/mL, corresponding to a specific activity is 1163.603 units/mg in the presence of 5 µg/mL of soluble IL-2 R beta and 10 ng/mL of recombinant human IL-2.

  • Alternative Names

    Cytokine receptor common subunit gamma; IL-2RG; p64; CD132

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    Q68FU6

  • Expression Region

    S25-A262

  • AA Sequence

    SKVLMSSGNEDTKSDLLLTSMDLKHLSVPTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTMHYRYKGSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAEQKLNLQNLVIPWAPENLTLYNLSESQVELRWKSRYIERCLQYLVQYRSNRDRSWTEQIVDHEPRFSLPSVDEQKLYTFRVRSRFNPICGSTQQWSKWSQPIHWGSHTAEENPSLFALEA

  • Protein Length

    Partial

  • Molecular Weight

    41-50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-2 receptor gamma (IL-2Rγ or CD132) is a critical component of the receptor complex for several interleukins, including interleukin-2 (IL-2), interleukin-4 (IL-4), interleukin-7 (IL-7), interleukin-9 (IL-9), interleukin-15 (IL-15), and interleukin-21 (IL-21), which play vital roles in immune system regulation and hematopoiesis. The importance of IL-2Rγ is highlighted in its involvement in various immune responses, lymphocyte development, and maintenance of immune homeostasis. Mutations or deficits in the IL-2Rγ gene are associated with severe combined immunodeficiency (SCID), underlining its role in T-cell and B-cell signaling. Consequently, the study of recombinant IL-2Rγ protein is crucial for understanding its structure-function relationship and developing therapeutic interventions for immune-related diseases. Production of recombinant IL-2Rγ enables detailed studies of its biological properties, interactions with ligands, and signaling pathways, offering insights into its mechanistic roles. Furthermore, recombinant IL-2Rγ can be utilized in drug development and immunotherapeutic applications, enhancing our understanding of immune modulation and opening avenues for targeted therapies in various disorders, including cancer and autoimmune diseases. Thus, research on IL-2Rγ, especially in recombinant form, is essential for advancing immunological therapies and enhancing our grasp of immune system intricacies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US