Analytical Data
-
Gene name
IL-2R gamma/CD132
-
简介
IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2. IL-2R gamma takes part in inflammatory response and mediates activation of the cells [1][2]. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types[3]. IL-2R gamma/CD132 Protein, Mouse (HEK293, His) is a recombinant mice extracellular region of IL-2R gamma with a C-Terminal 6*His tag, which is produced in HEK293 cells.
- Application
-
Alternative Names
IL-2RG; IL-2 R gamma; IL-2Rγ; IL2R γ; Interleukin 2 receptor, gamma chain, isoform CRA_b; Il2rg
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3UPA9
-
Expression Region
S25-A263
-
AA Sequence
SKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEA
-
Protein Length
Partial
-
Molecular Weight
50-75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-2 receptor gamma (IL-2Rγ or CD132) is a critical component of the receptor complex for several interleukins, including interleukin-2 (IL-2), interleukin-4 (IL-4), interleukin-7 (IL-7), interleukin-9 (IL-9), interleukin-15 (IL-15), and interleukin-21 (IL-21), which play vital roles in immune system regulation and hematopoiesis. The importance of IL-2Rγ is highlighted in its involvement in various immune responses, lymphocyte development, and maintenance of immune homeostasis. Mutations or deficits in the IL-2Rγ gene are associated with severe combined immunodeficiency (SCID), underlining its role in T-cell and B-cell signaling. Consequently, the study of recombinant IL-2Rγ protein is crucial for understanding its structure-function relationship and developing therapeutic interventions for immune-related diseases. Production of recombinant IL-2Rγ enables detailed studies of its biological properties, interactions with ligands, and signaling pathways, offering insights into its mechanistic roles. Furthermore, recombinant IL-2Rγ can be utilized in drug development and immunotherapeutic applications, enhancing our understanding of immune modulation and opening avenues for targeted therapies in various disorders, including cancer and autoimmune diseases. Thus, research on IL-2Rγ, especially in recombinant form, is essential for advancing immunological therapies and enhancing our grasp of immune system intricacies.











