Analytical Data
-
Gene name
IL-2R beta/CD122
-
简介
IL-2R beta (CD122), a type Ⅰ cytokine receptor expressed on T lymphocytes, is a receptor for IL-2 (Kd: 1 nM approximately)[1]. IL-2R beta mediates T cell immune responses, such as stimulating T cell proliferation and activating lymphokine-activated killer cells[2]. IL-2R beta/CD122 Protein, Canine (HEK293, His) is a recombinant canine IL-2R betawith a C-Terminal His tag, which is produced in HEK293 cells.
- Application
-
Biological Activity
Measured by its ability to inhibit the IL-15-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 0.4095 μg/mL in the presence of 4 ng/mL of recombinant human IL-15, corresponding to a specific activity is 2.44×103 units/mg. Measured by its ability to inhibit the IL-15-dependent proliferation of MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 0.4095 μg/mL in the presence of 4 ng/mL of recombinant human IL-15, corresponding to a specific activity is 2.44×103 units/mg.
-
Alternative Names
IL2RB; RP5-1170K4.6; CD122; P70-75
-
Species
Canine
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
A0A8C0MT13
-
Expression Region
N30-P246
-
AA Sequence
NADTSKLTCFYNSKANISCIWSWDGDLQATSCKIHAQPDRRPWNKSCELLPMRPAFWACYLILGSPDAQSLTSADVVGMSVMCHEGERWRILMTQDFKPFENLRLMAPNGLQVADVGTHKCNITWKVPQSSHYIKRYLEFEARKRSPGHSWEEASLMALRQNQQWISLETLTPDTLYEFQVRVRAQRGSHKTWSPWSQPLAFRTRPAARGKQSLPFP
-
Protein Length
Partial
-
Molecular Weight
33-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-2 receptor beta (IL-2Rβ/CD122) is a crucial component of the IL-2 receptor complex, which plays an essential role in the modulation of immune responses. This receptor is primarily expressed on activated T cells and natural killer (NK) cells and is involved in mediating the effects of interleukin-2 (IL-2), a key cytokine for T cell proliferation, differentiation, and survival. Research into IL-2Rβ/CD122 has gained prominence due to its implications in various immunological disorders, including autoimmune diseases, cancer, and infections. The receptor exists in different forms, including a high-affinity complex with IL-2Rα (CD25) and a lower-affinity form in conjunction with the common gamma chain (CD132). This diversity allows for fine-tuning of immune responses, making it a target for therapeutic interventions. Recombinant forms of IL-2Rβ/CD122 have been produced for both functional studies and potential clinical applications, including the development of novel immunotherapies. Understanding the structure and function of this receptor is essential for designing effective treatments that enhance immune responses or mitigate excessive inflammation. Thus, the continued exploration of IL-2Rβ/CD122 as a therapeutic target holds promise for advancing strategies to manipulate the immune system in various diseases.











