Analytical Data
-
Gene name
EPCR
-
简介
EPCR Protein, crucial in the protein C pathway, regulates blood coagulation by binding and enhancing the activation of activated protein C through the thrombin-thrombomodulin complex, ensuring effective control of hemostasis.EPCR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EPCR protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Immobilized Human Activated Protein C at 3 µg/mL (100 µL/well) can bind Mouse EPCR. The ED50 for this effect is 0.4145 μg/mL. Immobilized Human Activated Protein C at 3 µg/mL (100 µL/well) can bind Mouse EPCR. The ED50 for this effect is 0.4145 μg/mL.
-
Alternative Names
Endothelial Protein C Receptor; CD201; PROCR; EPCR
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
Q64695
-
Expression Region
L18-S214
-
AA Sequence
LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS
-
Protein Length
Extracellular Domain
-
Molecular Weight
30-48 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of EPCR (Endothelial Protein C Receptor) recombinant proteins has gained significance due to the pivotal role EPCR plays in the regulation of coagulation and inflammatory responses. EPCR is primarily expressed on the surface of endothelial cells and is critical for the activation of Protein C, which, in turn, modulates thrombin generation and possesses anti-inflammatory properties. Dysfunction or altered expression of EPCR is associated with various pathological conditions, including thrombosis, sepsis, and cardiovascular disorders. As researchers seek to understand the molecular mechanisms underlying these conditions, recombinant EPCR proteins offer valuable tools for elucidating EPCR's biological functions and interactions. Through the production and characterization of these recombinant proteins, scientists can explore their therapeutic potential, develop targeted treatments, and investigate their role in disease processes. Understanding EPCR's function could lead to novel strategies for manipulating coagulation pathways, enhancing the body’s natural anticoagulant mechanisms, and reducing inflammation, thus mitigating the impact of related diseases. Overall, the research surrounding EPCR recombinant proteins is crucial for advancing our comprehension of hemostasis and inflammation, with promising implications for future medical interventions.











