Cat: IPD-X17196

Recombinant Rat EPCR Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EPCR

  • 简介

    EPCR Protein plays a pivotal role in blood coagulation by binding to and enhancing the activation of protein C through interaction with the thrombin-thrombomodulin complex. Its significance lies in regulating coagulation processes and modulating protein C activation, a crucial factor in anticoagulant mechanisms. EPCR Protein, Rat (HEK293, His) is the recombinant rat-derived EPCR protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Immobilized Human Activated Protein C at 3 µg/mL (100 µL/well) can bind Rat EPCR. The ED50 for this effect is 0.2630 μg/mL. Immobilized Human Activated Protein C at 3 µg/mL (100 µL/well) can bind Rat EPCR. The ED50 for this effect is 0.2630 μg/mL.

  • Alternative Names

    Endothelial Protein C Receptor; CD201; PROCR; EPCR

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    Q4V8I1

  • Expression Region

    N21-S213

  • AA Sequence

    NSDGSQSLHMLQISYFPDPYHGRHQGNASLGKLLTHTLEGPSNNVTILQLQDWQDPDSWARTESGLKIYLSQFNSLVQLIYRERKNDVVFPLTVSCSVGCELPPEEGSEPHVFFDVAVNGSAFVSFQPKTAIWVTGSQEPSEAINFTLKQLNTYNRTRYELQEFLQDTCVQYLENHITTQNTKGSQTGRSYTS

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    30-40 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of EPCR (Endothelial Protein C Receptor) recombinant proteins has gained significance due to the pivotal role EPCR plays in the regulation of coagulation and inflammatory responses. EPCR is primarily expressed on the surface of endothelial cells and is critical for the activation of Protein C, which, in turn, modulates thrombin generation and possesses anti-inflammatory properties. Dysfunction or altered expression of EPCR is associated with various pathological conditions, including thrombosis, sepsis, and cardiovascular disorders. As researchers seek to understand the molecular mechanisms underlying these conditions, recombinant EPCR proteins offer valuable tools for elucidating EPCR's biological functions and interactions. Through the production and characterization of these recombinant proteins, scientists can explore their therapeutic potential, develop targeted treatments, and investigate their role in disease processes. Understanding EPCR's function could lead to novel strategies for manipulating coagulation pathways, enhancing the body’s natural anticoagulant mechanisms, and reducing inflammation, thus mitigating the impact of related diseases. Overall, the research surrounding EPCR recombinant proteins is crucial for advancing our comprehension of hemostasis and inflammation, with promising implications for future medical interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US