Cat: IPD-X10346

Recombinant Mouse IL-17A Protein (HEK293), C-Avi;C-8*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-17A

  • 简介

    IL-17A-17F Heterodimer Protein is the heterodimer of the cytokines IL-17A and IL-17F. Both IL-17A and IL-17F can induce antimicrobial peptides, cytokines (IL-6 and GM-CSF), chemokines (CCL2, CCL7 and CXCL1), and matrix metalloproteinases (MMP-1 and MMP13). IL-17A-17F shows intermediate biological activity between IL-17A and IL-17F[1][2][3][4]. IL-17A/F Heterodimer Protein, Mouse (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant mouse IL-17A-17F heterodimer protein with His tag and Avi tag at the C-terminus and is expressed in HEK293 cells.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL-17A; Interleukin-17A; CTLA-8; IL-17; IL-17F; IL24; ML-1; Interleukin-17F

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-Avi;C-8*His

  • Purity

    > 90% as determined by SDS-PAGE.

  • Uniprot

    Q62386 (A26-A158)&Q7TNI7

  • Expression Region

    Q62386 (A26-A158)&Q7TNI7-1 (R29-A161)

  • AA Sequence

    AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA&RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

  • Molecular Weight

    22-25 kDa & 27-30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Related Products

Protein Description

Interleukin-17A (IL-17A) is a pro-inflammatory cytokine primarily produced by a subset of T cells known as Th17 cells. It plays a crucial role in immune responses against extracellular pathogens and is implicated in various autoimmune and inflammatory diseases, including rheumatoid arthritis, psoriasis, and multiple sclerosis. The significance of IL-17A in modulating inflammation has spurred extensive research into its biological functions and potential therapeutic applications. Recombinant IL-17A proteins have been developed to better understand its signaling pathways and interactions with other immune components. These proteins serve as valuable tools for exploring the mechanisms underlying IL-17A-related pathologies and for identifying novel therapeutic targets. Moreover, the investigation of IL-17A-recombinant proteins has paved the way for the development of monoclonal antibodies that inhibit IL-17A activity, which have shown promise in clinical settings. By blocking IL-17A signaling, these agents can effectively reduce inflammation and improve outcomes for patients suffering from autoimmune diseases. Continuing research on IL-17A and its recombinant forms is essential not only for elucidating its role in immune regulation but also for advancing therapeutic strategies aimed at mitigating the detrimental effects of excessive IL-17A activity in various inflammatory conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US