Analytical Data
-
Gene name
4-1BBL/TNFSF9 Trimer
- Application
-
Biological Activity
1.Measured by its ability to co-stimulate IL-2 secretion by mouse T cells in the presence of anti-CD3. The ED50 for this effect is 1-10 ng/mL. 2.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse 4-1BBL at 2µg/mL (100 µL/well) can bind biotinylated Mouse 4-1BB. The ED50 for this effect is 0.4068 μg/mL. Measured by its ability to co-stimulate IL-2 secretion by mouse T cells in the presence of anti-CD3.The ED50 for this effect is 2.149 ng/mL, corresponding to a specific activity is 4.65×105 U/mg.
-
Alternative Names
rMu4-1BB Ligand/TNFSF9, His; 4-1BBL; CD137L; 4-1BB Ligand; TNFSF9
-
Species
Mouse
-
Source
HEK293
-
Tag
N-10*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE
-
Uniprot
P41274
-
Expression Region
R104-E309
-
AA Sequence
HHHHHHHHHHRTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE
-
Protein Length
Extracellular Domain
-
Molecular Weight
33-45 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
4-1BBL (also known as TNFSF9) is a member of the TNF superfamily and plays a crucial role in immune regulation, particularly in T cell activation and proliferation. It is primarily expressed on antigen-presenting cells and binds to its receptor, 4-1BB (CD137), found on T cells, promoting their survival and enhancing immune responses. The therapeutic potential of targeting the 4-1BB/4-1BBL axis has garnered significant interest, particularly in cancer immunotherapy, as it can enhance the anti-tumor immune response. However, the use of 4-1BBL as a therapeutic agent has been limited by its stability and bioavailability in vivo. To address these challenges, researchers have been focusing on developing a recombinant 4-1BBL trimer, which is expected to enhance its functional activity and therapeutic efficacy by improving its interaction with the 4-1BB receptor. The trimeric form is anticipated to provide a more stable and potent stimulus for T cell activation compared to monomeric forms. This engineering approach is critical for harnessing the full potential of the 4-1BB/4-1BBL pathway in various therapeutic applications, including cancer treatment, where robust T cell activation is essential for effective tumor eradication. Thus, the study of recombinant 4-1BBL trimers is positioned at the forefront of immunotherapy research, aiming to create innovative solutions for enhancing immune responses against malignancies and potentially other diseases.











