Cat: IPD-X14842

Recombinant Rat HER2/CD340 Protein , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HER2/CD340

  • 简介

    The HER2/CD340 protein is a key protein tyrosine kinase that is a component of multiple cell surface receptor complexes and requires coreceptors for ligand binding.Its interaction within the neuregulin-receptor complex depends on neuregulin, and GP30 emerges as a potential ligand.HER2/CD340 Protein, Rat (His) is the recombinant rat-derived HER2/CD340 protein, expressed by E.coli , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Receptor tyrosine-protein kinase erbB-2; p185neu; CD340; Erbb2; Neu

  • Species

    Rat

  • Source

    E. coli

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P06494

  • Expression Region

    A67-V323

  • AA Sequence

    ANASLSFLQDIQEVQGYMLIAHNQVKRVPLQRLRIVRGTQLFEDKYALAVLDNRDPQDNVAASTPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVFRKNNQLAPVDIDTNRSRACPPCAPACKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMHNPEGRYTFGASCVTTCPYNYLSTEVGSCTLVCPPNNQEV

  • Protein Length

    Partial

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HER2, also known as CD340, is a member of the human epidermal growth factor receptor (HER/EGFR) family and plays a crucial role in cell growth, differentiation, and survival. Overexpression of HER2 is associated with aggressive forms of breast cancer and has been linked to poor prognosis, making it a significant target for therapeutic intervention. Research into HER2/CD340 recombinant proteins is primarily driven by the need for targeted therapies, such as monoclonal antibodies and small molecule inhibitors, that can specifically disrupt the signaling pathways activated by HER2 overexpression. These recombinant proteins can be utilized in various applications, including the development of diagnostic tools to identify HER2-positive tumors and the creation of novel therapeutic agents like antibody-drug conjugates that deliver cytotoxic drugs directly to cancer cells. Furthermore, understanding the structure and function of HER2/CD340 at the molecular level facilitates the design of more effective inhibitors and enhances the potential for personalized medicine approaches. Rigorous studies on HER2/CD340 recombinant proteins continue to provide insights into its mechanics and role in oncogenesis, paving the way for innovative strategies to combat HER2-positive cancers and ultimately improve patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US