Analytical Data
-
Gene name
CD157
- Application
-
Alternative Names
rHuCD157, His; ADP-ribosyl cyclase; ADP-ribosyl cyclase 2; Bone marrow stromal antigen 1; BST1; Cyclic ADP-ribose hydrolase 2; CD157
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q10588
-
Expression Region
G29-K292
-
AA Sequence
GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKHHHHHH
-
Protein Length
Partial
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD157, also known as bone marrow stromal antigen 1 (BSA-1), is a member of the NAD+-glycohydrolase family and is primarily expressed on the surface of various immune cells, including monocytes and lymphocytes. It plays a significant role in modulating immune responses, promoting cell adhesion, and influencing cellular signaling pathways. The interest in CD157 has surged in recent years due to its involvement in immune regulation and potential implications in various diseases, including cancer, autoimmune disorders, and chronic inflammatory conditions. Recombinant CD157 protein has emerged as a valuable tool for researchers to study its functional roles and interactions within the immune system. By creating a purified form of this protein, scientists can perform in-depth analyses of its enzymatic activities, receptor interactions, and potential therapeutic applications. This research aims to elucidate the intricate mechanisms by which CD157 modulates immune responses and to explore its potential as a target for novel immunotherapies. Understanding the structure and function of CD157 can lead to innovative strategies for manipulative interventions in diseases exacerbated by immune dysregulation, thereby highlighting its importance in the field of immunology and therapeutic development.











