Cat: IPD-X50159

Recombinant Human AKT1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AKT1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AKT1; AKT; PKB-A; Proto-oncogene c-Akt; RAC-Alpha Serine/Threonine-Protein Kinase; V-akt Murine Thymoma Viral Oncogene Homolog 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His Tag

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P31749

  • Expression Region

    1-480aa

  • Protein Length

    MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNN FSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVAD GLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFG KVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYS FQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNV VYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDN DYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKS LLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSE TDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA

  • Molecular Weight

    58.1kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AKT1, also known as Protein Kinase B, is a critical serine/threonine kinase that plays a pivotal role in various cellular processes, including glucose metabolism, apoptosis, cell proliferation, and growth factor signaling. Its dysregulation has been implicated in numerous diseases, particularly cancer, as AKT1 is often found to be overactive or mutated in various tumor types, leading to enhanced survival and growth of cancer cells. Given its central role in the phosphoinositide 3-kinase (PI3K) signaling pathway, AKT1 has emerged as a promising target for therapeutic interventions. Research on recombinant AKT1 protein is vital, as it allows for the detailed study of its biochemical properties, regulatory mechanisms, and interactions with other signaling molecules. By producing AKT1 through recombinant DNA technology, scientists can investigate its functional role in vitro and in vivo, paving the way for the development of specific inhibitors and biomarkers for cancer diagnosis and treatment. Furthermore, understanding the dynamics of AKT1 phosphorylation and its downstream targets can elucidate the complex signaling networks involved in cellular responses to stress and growth signals. The study of recombinant AKT1 not only enhances our understanding of its physiological relevance but also contributes to the identification of potential drug targets, offering hope for novel therapeutic strategies in cancer treatment and other metabolic disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US