Cat: IPD-X50047

Recombinant Mouse TLR4/MD-2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TLR4/MD-2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TLR4;Toll-like receptor 4

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-terminal His Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9JHF9&Q9QUK6

  • Expression Region

    16-159aa & 26-269aa

  • AA Sequence

    TESEKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRG NLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEG ILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDV NPCIEVVPNITYQCMDQKLSKVPDDIPSSTKNIDLSFNPLKILKSYSFSNFSEL QWLDLSRCEIETIEDKAWHGLHHLSNLILTGNPIQSFSPGSFSGLTSLENLVAV ETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYNYIQ TITVNDLQFLRENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNFNSSNI MKTCLQNLAGLHVHRLILGEFKDERNLE

  • Molecular Weight

    19.9/ 31.0kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Toll-like receptor 4 (TLR4) is a crucial component of the innate immune system, playing a significant role in recognizing pathogen-associated molecular patterns (PAMPs) and initiating immune responses. The study of TLR4 and its recombinant protein has garnered considerable attention due to its involvement in various infectious and inflammatory diseases. TLR4 recognizes lipopolysaccharides (LPS) from Gram-negative bacteria, leading to the activation of downstream signaling pathways that elevate the expression of pro-inflammatory cytokines, chemokines, and other immune mediators. Dysregulation of TLR4 signaling is associated with numerous pathological conditions, including sepsis, autoimmune disorders, and chronic inflammation. Recombinant TLR4 proteins have emerged as valuable tools for research, allowing scientists to explore its structure-function relationship, ligand interactions, and signaling mechanisms in a controlled environment. Furthermore, the generation of TLR4 recombinant proteins facilitates the development of therapeutic strategies aimed at modulating TLR4 activity, either by enhancing its function to boost immune responses or by inhibiting it in conditions of excessive inflammation. This dual potential positions TLR4 as a key target for new interventions in treating infections and inflammatory diseases, thereby highlighting the importance of continued research into its recombinant forms.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US