Cat: PA2000-2940

Recombinant Coxiella rnfH Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    rnfH

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rnfH;Protein RnfH

  • Species

    Coxiella

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    B6IZH9

  • Expression Region

    1-101aa

  • AA Sequence

    MISIIIAYATPEKQVEIPLTVEESCTLVVAVKRSGILQQFPEINLSQAIVGIHNKRTALDAGLRDGDRIEIYRPLTMDPKQARLLRAKRGKIRRMVRGEAG

  • Molecular Weight

    27.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The rnfH gene, known to encode a Na+-translocating ferredoxin:NADP+ oxidoreductase, has garnered significant interest due to its role in energy metabolism in various microorganisms, particularly in anaerobic environments. This enzyme is crucial for the biological conversion of energy from electron donors to applicable forms for cellular processes. The study of recombinant rnfH proteins has grown in relevance as researchers seek to elucidate the mechanistic details of Na+ transport and its coupling to redox reactions, which are fundamental to bioenergetics. Investigating rnfH recombinants can provide insights into the evolution of electron transport systems, highlight potential biotechnological applications, and improve our understanding of microbial physiology under different environmental conditions. Furthermore, characterizing the recombinant protein's structure and function can pave the way for innovative approaches in metabolic engineering, bioenergy production, and bioremediation strategies, contributing to sustainable development. Overall, the exploration of rnfH and its recombinant variants stands at the intersection of microbiology, biochemistry, and applied sciences, making it a vital area of study.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US