Analytical Data
-
Gene name
FFAR3
- Application
-
Alternative Names
FFAR3；GPR41；Free fatty acid receptor 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14843
-
Expression Region
280-346aa
-
AA Sequence
SSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES
-
Molecular Weight
39.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The FFAR3 (Free Fatty Acid Receptor 3), also known as GPR41, belongs to the family of G protein-coupled receptors (GPCRs) and plays a vital role in mediating the physiological responses to short-chain fatty acids (SCFAs), which are produced through the fermentation of dietary fibers by gut microbiota. Understanding FFAR3 is increasingly important due to its implications in various metabolic processes, including appetite regulation, energy metabolism, and inflammatory responses. Research has shown that FFAR3 activation can influence insulin sensitivity and contribute to the prevention of obesity-related disorders, making it a potential therapeutic target for metabolic diseases, including type 2 diabetes and obesity. Investigations into FFAR3 recombinant proteins focus on elucidating the receptor's signaling pathways and exploring its interactions with various ligands. By generating and studying FFAR3 recombinant proteins, scientists aim to better understand the receptor's structure-function relationships and how different SCFAs can modulate its activity. This knowledge is crucial for developing novel treatments that harness the beneficial effects of SCFAs on metabolic health, as well as for creating more effective dietary strategies to promote gut health and overall well-being. As research progresses, FFAR3 continues to emerge as a significant player in the complex interplay between diet, gut microbiota, and host metabolism, underscoring the importance of targeted studies on its recombinant form.
