Cat: PA1000-8797

Recombinant Human FFAR3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FFAR3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FFAR3;GPR41;Free fatty acid receptor 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O14843

  • Expression Region

    280-346aa

  • AA Sequence

    SSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES

  • Molecular Weight

    39.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The FFAR3 (Free Fatty Acid Receptor 3), also known as GPR41, belongs to the family of G protein-coupled receptors (GPCRs) and plays a vital role in mediating the physiological responses to short-chain fatty acids (SCFAs), which are produced through the fermentation of dietary fibers by gut microbiota. Understanding FFAR3 is increasingly important due to its implications in various metabolic processes, including appetite regulation, energy metabolism, and inflammatory responses. Research has shown that FFAR3 activation can influence insulin sensitivity and contribute to the prevention of obesity-related disorders, making it a potential therapeutic target for metabolic diseases, including type 2 diabetes and obesity. Investigations into FFAR3 recombinant proteins focus on elucidating the receptor's signaling pathways and exploring its interactions with various ligands. By generating and studying FFAR3 recombinant proteins, scientists aim to better understand the receptor's structure-function relationships and how different SCFAs can modulate its activity. This knowledge is crucial for developing novel treatments that harness the beneficial effects of SCFAs on metabolic health, as well as for creating more effective dietary strategies to promote gut health and overall well-being. As research progresses, FFAR3 continues to emerge as a significant player in the complex interplay between diet, gut microbiota, and host metabolism, underscoring the importance of targeted studies on its recombinant form.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US