Analytical Data
-
Gene name
UXS1
- Application
-
Alternative Names
UXS1; UNQ2538/PRO6079; UDP-glucuronic acid decarboxylase 1; EC 4.1.1.35; UDP-glucuronate decarboxylase 1; UGD; UXS-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NBZ7
-
Expression Region
1-420 aa
-
AA Sequence
MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMRSIQENGELKIESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS
-
Molecular Weight
74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The UXS1 gene encodes an enzyme crucial for the biosynthesis of uronic acids, which are important components of plant cell walls and polysaccharides. This enzyme, known as UXS1 (UDP-glucuronic acid decarboxylase), plays a significant role in the production of glucuronic acid, a precursor for various polysaccharides involved in plant growth, development, and stress responses. Research on UXS1 has gained attention due to its implications in enhancing plant resilience to environmental stresses, improving biomass production, and modifying cell wall composition for better industrial application. Moreover, understanding the regulatory mechanisms that control UXS1 expression can provide insights into the metabolic pathways of plant development and adaptation. This knowledge is particularly relevant in the context of biotechnology, where manipulation of UXS1 could lead to higher-yielding and more resilient crops, thereby addressing food security challenges in the face of climate change. Recent studies have employed various techniques, such as gene editing and transgenic approaches, to elucidate the functional dynamics of UXS1 in different plant species. The ongoing investigation into UXS1 not only enhances our understanding of plant biology but also paves the way for innovative agricultural practices that leverage genetic traits for improved crop performance. Ultimately, the exploration of UXS1 could contribute significantly to sustainable agriculture and the development of bio-based materials, making it a critical area of research in both plant science and applied biotechnology.
