Cat: IPD-X14572

Recombinant Mouse Jagged-1/JAG1 Protein , His & SUMO

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Jagged-1/JAG1

  • 简介

    Jagged-1/JAG1 protein is a multifunctional ligand that binds to multiple Notch receptors and mediates Notch signaling.It influences cell fate decisions during hematopoiesis, spans early and late mammalian cardiovascular development, and regulates myoblast differentiation.Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Jagged-1/JAG1 protein, expressed by E.coli , with C-Myc, N-SUMO, N-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Jag1; Protein jagged-1; Jagged1; CD antigen CD339

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    C-Myc;N-SUMO;N-10*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9QXX0

  • Expression Region

    G33-E334

  • AA Sequence

    GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCE

  • Protein Length

    Partial

  • Molecular Weight

    53.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Jagged-1 (JAG1) is a critical ligand in the Notch signaling pathway, which plays a vital role in various biological processes, including cell differentiation, proliferation, and apoptosis. Dysregulation of the Notch pathway, particularly involving JAG1, is implicated in numerous diseases, including cancer and developmental disorders. JAG1 interacts with Notch receptors on adjacent cells, triggering signaling cascades that influence cellular fate. Research into recombinant JAG1 protein focuses on understanding its structure-function relationship and its role in mediating intercellular communications. Recombinant JAG1 can be produced using various expression systems, enabling detailed studies on its interaction with Notch receptors and downstream signaling effects. Investigating the biochemical properties of JAG1, including its binding affinity and signaling efficacy, may provide insights into therapeutic targets for conditions associated with Notch signaling dysregulation. Additionally, recombinant JAG1 has potential applications in regenerative medicine and tissue engineering, as it could enhance cell survival and differentiation in therapeutic settings. The production and characterization of JAG1, therefore, represent a significant area of interest for advancing our understanding of Notch signaling and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US