Analytical Data
-
Gene name
FAM164C
- Application
-
Alternative Names
ZC2HC1C; C14orf140; FAM164C; Zinc finger C2HC domain-containing protein 1C
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q53FD0
-
Expression Region
1-275aa
-
AA Sequence
MAGLQRLASHLPVGVMLPHNTTEAPGPHSAKQDSYEQGDSSQQSLKGHLRNNFQKQLLSNKELILDKVYTHPKWNTQTKARSYSYPHCTGISQQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLKPMVHRKSCSTGEAGTDGDHNVYPRPPEPREFSSRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEWVQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQKEQAKENENGELQKIILPRSRVKG
-
Molecular Weight
57.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM164C, known as Family With Sequence Similarity 164 Member C, is a protein that has garnered attention in the field of molecular biology due to its potential implications in human health and disease. Initially identified through genomic studies, FAM164C is believed to play a role in cellular processes such as cell proliferation, differentiation, and apoptosis. Recent research has linked alterations in FAM164C expression to various pathologies, including certain cancers and neurodegenerative disorders. The study of recombinant FAM164C protein has become essential for unraveling its biological functions and mechanisms of action. By producing this protein in a recombinant form, researchers aim to investigate its structure-function relationships, interactions with other cellular components, and its potential as a therapeutic target. Advances in recombinant DNA technology and protein purification methods have facilitated the generation of high-quality FAM164C protein, allowing for detailed biochemical assays and structural studies. Understanding the role of FAM164C in health and disease may lead to novel diagnostic and therapeutic strategies, highlighting its significance in contemporary biomedical research.
