Analytical Data
-
Gene name
KIR2DS1
- Application
-
Alternative Names
KIR2DS1;CD158H;Killer cell immunoglobulin-like receptor 2DS1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14954
-
Expression Region
22-245aa
-
AA Sequence
HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
-
Molecular Weight
26.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIR2DS1, a member of the Killer Immunoglobulin-like Receptor (KIR) family, is a key receptor expressed on natural killer (NK) cells, playing a crucial role in immune response regulation. Comprehending KIR2DS1's structure and function is vital for understanding NK cell-mediated immunity, particularly in contexts like cancer and viral infections. Unlike its inhibitory counterparts, KIR2DS1 is activating and interacts with specific ligands, which can modulate NK cell activation and cytotoxicity. Research has shown that this receptor can influence the outcomes of various diseases, including its association with a better prognosis in certain cancers. However, the precise molecular mechanisms and signaling pathways underlying KIR2DS1's actions remain to be fully elucidated. The study of recombinant KIR2DS1 proteins offers valuable insights into its ligand interactions and functional roles, paving the way for potential therapeutic strategies that harness NK cell activity in immunotherapy. By investigating the recombinant expression of KIR2DS1, researchers aim to explore its structural features, binding properties, and impact on NK cell functionality, which could lead to advancements in targeted cancer therapies and enhance our understanding of the immune system's intricacies.











