Cat: PA2000-3061

Recombinant Human KIR2DS1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KIR2DS1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KIR2DS1;CD158H;Killer cell immunoglobulin-like receptor 2DS1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14954

  • Expression Region

    22-245aa

  • AA Sequence

    HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

  • Molecular Weight

    26.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KIR2DS1, a member of the Killer Immunoglobulin-like Receptor (KIR) family, is a key receptor expressed on natural killer (NK) cells, playing a crucial role in immune response regulation. Comprehending KIR2DS1's structure and function is vital for understanding NK cell-mediated immunity, particularly in contexts like cancer and viral infections. Unlike its inhibitory counterparts, KIR2DS1 is activating and interacts with specific ligands, which can modulate NK cell activation and cytotoxicity. Research has shown that this receptor can influence the outcomes of various diseases, including its association with a better prognosis in certain cancers. However, the precise molecular mechanisms and signaling pathways underlying KIR2DS1's actions remain to be fully elucidated. The study of recombinant KIR2DS1 proteins offers valuable insights into its ligand interactions and functional roles, paving the way for potential therapeutic strategies that harness NK cell activity in immunotherapy. By investigating the recombinant expression of KIR2DS1, researchers aim to explore its structural features, binding properties, and impact on NK cell functionality, which could lead to advancements in targeted cancer therapies and enhance our understanding of the immune system's intricacies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US