Analytical Data
-
Gene name
CFH
- Application
-
Alternative Names
CFH；HF；HF1；HF2；Complement factor H
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08603
-
Expression Region
19-449aa
-
AA Sequence
EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCS
-
Molecular Weight
50.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CFH (Complement Factor H) is a crucial regulatory protein in the complement system, playing a significant role in immune response and inflammation regulation. Its primary function is to inhibit the alternative pathway of complement activation, thus preventing excessive tissue damage and promoting homeostasis. Dysregulation or mutations in CFH are linked to various diseases, particularly age-related macular degeneration (AMD), which can lead to vision loss. Additionally, CFH has been implicated in conditions such as atypical hemolytic uremic syndrome (aHUS) and certain autoimmune disorders. Due to its significant impact on immune regulation and disease progression, CFH has become a focal point for biomedical research. Recombining CFH through recombinant DNA technology allows for the production of various isoforms, enhancing our understanding of its structure-function relationships and providing insights into potential therapeutic applications. These efforts aim to develop CFH-based therapies or biomarker identification, which could improve treatment options for patients suffering from CFH-related diseases. The exploration of CFH also sheds light on the broader mechanisms of the complement system, presenting opportunities to explore novel strategies in immunotherapy and regenerative medicine. Overall, research into CFH and its recombinant forms offers the potential for groundbreaking advancements in understanding and treating diseases associated with complement dysregulation.
