Cat: PA2000-2898

Recombinant Staphylococcus aureus entC1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    entC1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    entC1;HLA-DRA1;HLA class II histocompatibility antigen. DR alpha chain

  • Species

    Staphylococcus aureus

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01553

  • Expression Region

    28-266aa

  • AA Sequence

    ESQPDPTPDELHKASKFTGLMENMKVLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEGLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG

  • Molecular Weight

    43.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EntC1 is a recombinant protein derived from the biosynthetic pathway of enterobactin, a siderophore produced by many Gram-negative bacteria for iron sequestration. The study of EntC1 has gained significant attention due to its critical role in bacterial iron transport and its implications for understanding microbial physiology and pathogenicity. Enterobactin and its derivatives are essential for bacterial survival in iron-limited environments, such as those encountered in host organisms. Research into EntC1 focuses on its enzymatic functions in the assembly of the enterobactin molecule, specifically its involvement in the condensation of 2,3-dihydroxybenzoate and its interactions with other enzymes in the biosynthetic pathway. Understanding the structure and function of EntC1 not only aids in unraveling the molecular mechanisms behind iron acquisition in bacteria but also opens avenues for the development of novel antimicrobial strategies, as targeting this pathway could hinder bacterial growth. Furthermore, insights into the recombinant production of EntC1 contribute to advancements in biotechnology and synthetic biology, where understanding and manipulating such biosynthetic pathways can lead to innovative applications in drug development and environmental bioremediation. As antibiotic resistance remains a pressing global health issue, exploring the unique features of EntC1 and its role in bacteria may provide critical information for designing new therapeutic approaches. Overall, the research on EntC1 represents a convergence of microbiology, biochemistry, and pharmacology, highlighting its potential importance in both fundamental and applied sciences.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US