Cat: PA1000-6073

Recombinant mouse REG3D Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    REG3D

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    REG3D;

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9QYF8

  • Expression Region

    1-98aa

  • AA Sequence

    MVSHKTLHSMSWMLLCEQSQKKLSSPRISCPQEAQAYGSYCYLLILEPQTWANAEIHCQKHFSGHLAFLLTYGEIIFVSSLVKNSLTTFPYIWIGLHD

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

REG3D, a member of the Regenerating Islet-Derived (REG) protein family, has garnered significant interest in the field of biomedical research due to its multifaceted role in various physiological and pathophysiological processes. Initially identified for its critical functions in pancreatic beta-cell regeneration, REG3D has been implicated in the immune response, particularly in aspects related to inflammation and tissue repair. Its expression is primarily induced in response to inflammatory stimuli, positioning REG3D as a potential biomarker for inflammatory diseases and a target for therapeutic interventions. The protein exhibits antimicrobial properties, particularly against gram-positive bacteria, suggesting its involvement in innate immunity. Research has expanded to explore REG3D's potential in metabolic disorders, cancer, and neurodegenerative diseases, reflecting its significance beyond pancreas-related functions. Given its diverse roles, the recombinant production of REG3D allows for in-depth studies to elucidate its mechanisms of action, interactions with other proteins, and potential clinical applications. Scientists are particularly focused on harnessing REG3D’s properties for developing novel treatments to modulate inflammation and enhance tissue repair, making it a promising candidate in regenerative medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US