Analytical Data
-
Gene name
mutT
- Application
-
Alternative Names
mutT；MTH2；Nucleotide triphosphate diphosphatase NUDT15
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08337
-
Expression Region
1-129aa
-
AA Sequence
MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
-
Molecular Weight
30.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MutT protein, originally identified for its role in DNA repair, is a critical enzyme that hydrolyzes 8-oxodGTP (8-oxodeoxyguanosine triphosphate), a mutagenic nucleotide that arises from oxidative stress. This enzyme prevents the incorporation of oxidized nucleotides into DNA, thus preserving genomic integrity and preventing mutations that could lead to various diseases, including cancer. MutT belongs to the Nudix hydrolase family, characterized by a conserved Nudix motif that facilitates the hydrolysis of nucleotide substrates. Research on MutT has garnered attention due to its potential implications in cellular response mechanisms to oxidative damage and its role in the maintenance of a stable genome. Understanding the structure-function relationship of MutT, along with its interaction with other cellular components, can unveil new insights into the mechanisms of DNA repair and the larger context of cellular stress responses. Moreover, studying the mutagenic effects of 8-oxodGTP and the role of MutT in mitigating these effects may lead to advancements in biomedicine, particularly in developing therapeutic strategies to combat diseases linked to oxidative stress and genomic instability. The exploration of MutT's biochemical properties, regulatory mechanisms, and its evolutionary significance further emphasizes its importance in maintaining cellular health, positioning it as a key player in the field of molecular biology and genetics.
