Analytical Data
-
Gene name
SCP
- Application
-
Alternative Names
SCP；Sterol carrier Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P89458
-
Expression Region
1-112aa
-
AA Sequence
MAAPQFHRPSTITADNVRALGMRGLVLATNNAQFIMDNSYPHPHGTQGAVREFLRGQAAALTDLGVTHANNTFAPQPMFAGDAAAEWLRPSFGLKRTYSPFVVRDPKTPSTP
-
Molecular Weight
19.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCP (Sperm-Centered Proteins) are a class of proteins originally identified in the context of reproductive biology, particularly in relation to sperm function and fertilization processes. Research into SCPs has gained prominence due to their potential roles in various physiological and pathological conditions. These proteins are believed to play critical roles in sperm motility, sperm-egg recognition, and immune modulation during conception. Additionally, SCPs are being studied for their implications in male infertility, as abnormalities in these proteins can lead to compromised reproductive capabilities. Advances in proteomics and molecular biology have facilitated a deeper understanding of SCPs' structure, function, and regulatory mechanisms. Recent studies have begun to explore their therapeutic potential, particularly in assisted reproductive technologies (ART) and contraception. By characterizing the specific SCPs involved in sperm interaction with the female reproductive tract, researchers aim to develop novel diagnostic and treatment strategies addressing fertility issues. Furthermore, SCPs are also being investigated for their broader relevance in immunology and cancer biology, offering insights into the intersection of reproduction and systemic health. This multidisciplinary approach underscores the significance of SCP research in both reproductive science and its potential applications beyond it.
