Analytical Data
-
Gene name
C22orf26
- Application
-
Alternative Names
PRR34; C22orf26; Proline-rich Protein 34
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NV39
-
Expression Region
1-138aa
-
AA Sequence
MPASATAAWHCPPLCLPPLPASAPTSPPNPATRPAPGPGRRARCPQSAHPAPTRGALTFWAPGSWPRVLLVPRSPGPVLRAPRLPHPAARARRRAWHGARLPGSPARAGRTFQRGLVSNSWAHAIFLPRPPNVLELQV
-
Molecular Weight
15.2 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C22orf26, a gene located on chromosome 22, has gained attention in recent years due to its potential role in various cellular processes and its implications in human health. Initially identified as an orphan gene, its function remained largely unknown until studies began to elucidate its significance. Recent research indicates that C22orf26 may play a crucial role in cellular stress responses and protein homeostasis, possibly through its involvement in cellular pathways such as the unfolded protein response. Mutations in C22orf26 have been associated with certain genetic disorders, highlighting its potential as a biomarker for disease diagnosis and prognosis. Additionally, the protein product of C22orf26 has been linked to the functioning of cilia, suggesting a role in developmental processes and cellular signaling. The recombinant expression and characterization of C22orf26 protein are therefore essential for further understanding its biological functions and mechanisms of action. By generating and studying this protein, researchers aim to uncover insights into its structural properties, interaction networks, and contributions to cellular pathways, ultimately paving the way for therapeutic interventions targeting disorders associated with dysregulation of C22orf26. Overall, understanding C22orf26 holds promise for advancing our knowledge of both fundamental biology and clinical applications in genetics and medicine.
