Cat: PA2000-2423

Recombinant E.coli omcB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    omcB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    omcB;omp2;omp2B;Large cysteine-rich periplasmic Protein OmcB

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P23700

  • Expression Region

    41-196aa

  • AA Sequence

    SAETKPAPVPMTAKKVRLVRRNKQPVEQKSRGAFCDKEFYPCEEGRCQPVEAQQESCYGRLYSVKVNDDCNVEICQSVPEYATVGSPYPIEILAIGKKDCVDVVITQQLPCEAEFVSSDPETTPTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGC

  • Molecular Weight

    24.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

OmcB, an outer membrane cytochrome, plays a crucial role in the electron transfer processes of certain bacteria, particularly Geobacter species, which are known for their unique ability to transfer electrons to solid substrates during anaerobic respiration. This characteristic makes OmcB a significant subject of study in bioenergy and bioremediation applications, as these bacteria can be harnessed for microbial fuel cells or in the cleanup of contaminated environments. Research has shown that OmcB is essential for the reduction of metal oxides and supports the extracellular electron transfer (EET) mechanisms that enable these microorganisms to survive in low-energy environments. The structural and functional characterization of recombinant OmcB provides insights into its electron transfer capabilities and interactions with other cellular components. These studies are instrumental in elucidating the molecular mechanisms underlying extracellular electron transfer, contributing to advancements in biotechnology and environmental engineering. Understanding the properties of recombinant OmcB also opens avenues for developing novel biotechnological applications, such as biosensors or enhanced bioremediation strategies, thereby highlighting the potential of manipulating microbial processes for sustainable energy and environmental solutions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US