Analytical Data
-
Gene name
omcB
- Application
-
Alternative Names
omcB；omp2；omp2B；Large cysteine-rich periplasmic Protein OmcB
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23700
-
Expression Region
41-196aa
-
AA Sequence
SAETKPAPVPMTAKKVRLVRRNKQPVEQKSRGAFCDKEFYPCEEGRCQPVEAQQESCYGRLYSVKVNDDCNVEICQSVPEYATVGSPYPIEILAIGKKDCVDVVITQQLPCEAEFVSSDPETTPTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGC
-
Molecular Weight
24.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OmcB, an outer membrane cytochrome, plays a crucial role in the electron transfer processes of certain bacteria, particularly Geobacter species, which are known for their unique ability to transfer electrons to solid substrates during anaerobic respiration. This characteristic makes OmcB a significant subject of study in bioenergy and bioremediation applications, as these bacteria can be harnessed for microbial fuel cells or in the cleanup of contaminated environments. Research has shown that OmcB is essential for the reduction of metal oxides and supports the extracellular electron transfer (EET) mechanisms that enable these microorganisms to survive in low-energy environments. The structural and functional characterization of recombinant OmcB provides insights into its electron transfer capabilities and interactions with other cellular components. These studies are instrumental in elucidating the molecular mechanisms underlying extracellular electron transfer, contributing to advancements in biotechnology and environmental engineering. Understanding the properties of recombinant OmcB also opens avenues for developing novel biotechnological applications, such as biosensors or enhanced bioremediation strategies, thereby highlighting the potential of manipulating microbial processes for sustainable energy and environmental solutions.
