Analytical Data
-
Gene name
RAG1AP1
- Application
-
Alternative Names
SLC50A1; RAG1AP1; SCP; Sugar transporter SWEET1; HsSWEET1; RAG1-activating protein 1; Solute carrier family 50 member 1; Stromal cell protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BRV3
-
Expression Region
1-167 aa
-
AA Sequence
MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILIVVNTVGAALQTLYILAYLHYCPRKAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT
-
Molecular Weight
45.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAG1AP1, or RAG1-activating protein 1, is a critical component in the V(D)J recombination process, a fundamental mechanism for generating diverse antigen receptors in lymphocytes. This protein plays a pivotal role in activating the Recombinase-Activating Gene (RAG) proteins, which are essential for the rearrangement of immunoglobulin and T-cell receptor genes. The study of RAG1AP1 is particularly significant as it helps in understanding the immune system's adaptability and the development of lymphoid malignancies. Mutations or dysregulation in RAG1AP1 can lead to severe immunodeficiencies or contribute to the pathogenesis of various cancers, highlighting its importance in both basic immunology and clinical implications. Research efforts are increasingly focusing on the molecular mechanisms underlying RAG1AP1's function, interactions with other cellular proteins, and its potential as a therapeutic target. Understanding RAG1AP1 could provide insights into novel strategies for treating immune disorders and cancers, underscoring its relevance in both health and disease. Continued exploration of RAG1AP1 and its pathways stands to illuminate the complexities of immune system functioning and the broader implications of these processes within the field of medical research.
