Analytical Data
-
Gene name
C16orf5
- Application
-
Alternative Names
CDIP1; C16orf5; CDIP; LITAFLCell death-inducing p53-target Protein 1; Cell death involved p53-target; Cell death-inducing Protein; LITAF-like Protein; Lipopolysaccharide-induced tumor necrosis factor-alpha-like Protein; Transmembrane Protein I1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H305
-
Expression Region
1-208aa
-
AA Sequence
MSSEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGMPLPPADIGPPPYEPPGHPMPQPGFIPPHMSADGTYMPPGFYPPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKRLC
-
Molecular Weight
48.51 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C16orf5, also known as GPR156, is a gene located on chromosome 16 that has garnered attention due to its potential involvement in various biological processes and diseases. Recent studies suggest that C16orf5 may play a role in cell signaling pathways, particularly in neural development and function. Its expression has been linked to conditions such as neurodegenerative diseases and cancers, highlighting its significance in medical research. The recombinant protein of C16orf5 facilitates the investigation of its functional properties and interactions at a molecular level. By producing and purifying this protein, researchers aim to elucidate the biological mechanisms underlying its role in disease processes and to explore its potential as a therapeutic target. Moreover, characterizing the C16orf5 recombinant protein can provide insights into its structure and functional domains, which may aid in the development of novel diagnostic and therapeutic strategies. As the field of protein research advances, understanding C16orf5 is crucial for unraveling its contributions to human health and disease.
