Analytical Data
-
Gene name
ANGPTL2/Angiopoietin-like 2
-
简介
ANGPTL2/Angiopoietin-like 2 protein plays a crucial role in inducing sprouting in endothelial cells through autocrine and paracrine mechanisms.It orchestrates angiogenic processes and regulates vascular development.ANGPTL2's versatile impact on endothelial cell behavior positions it as a key modulator in the molecular signals governing angiogenesis.ANGPTL2/Angiopoietin-like 2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived ANGPTL2/Angiopoietin-like 2 protein, expressed by HEK293 , with N-hFc labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse ANGPTL2/Angiopoietin-like 2 at 1 μg/mL (100 μL/well) can bind Recombinant Human ILT-4. The ED50 for this effect is 517.3 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse ANGPTL2/Angiopoietin-like 2 at 1 μg/mL (100 μL/well) can bind Recombinant Human ILT-4.The ED50 for this effect is 517.3ng/mL.
-
Alternative Names
Angiopoietin-related protein 2; ANGPTL2; ANGRP2; ARP2HARP; MGC8889
-
Species
Mouse
-
Source
HEK293
-
Tag
N-hFc
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
Q9R045
-
Expression Region
D245-H493
-
AA Sequence
DQNLKVLPPSLPTMPALTSLPSSTDKPSGPWRDCLQALEDGHSTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH
-
Protein Length
Partial
-
Molecular Weight
58 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANGPTL2, or angiopoietin-like protein 2, is a member of the angiopoietin-like family, which plays a crucial role in various physiological and pathological processes, including metabolism, inflammation, and cardiovascular diseases. It is primarily secreted by adipose tissue and has been implicated in metabolic disorders such as obesity and insulin resistance. Elevated levels of ANGPTL2 in the bloodstream correlate with adverse metabolic outcomes and inflammatory responses, making it a potential biomarker for conditions like type 2 diabetes and cardiovascular diseases. Research on recombinant ANGPTL2 protein has focused on elucidating its biological functions and mechanisms of action, providing insights into its role in cellular signaling and the regulation of energy homeostasis. Investigating the effects of ANGPTL2 not only contributes to our understanding of metabolic disease pathogenesis but also offers potential therapeutic avenues for targeting this molecule in the treatment of obesity-related disorders. The development of recombinant ANGPTL2 proteins has enabled various experimental studies, including the assessment of its impact on cell proliferation, migration, and inflammation, which are critical for developing strategies to modulate its activity in metabolic diseases. This research advances the understanding of the interconnectedness between ANGPTL2 and key metabolic pathways, highlighting its relevance in therapeutic contexts. As a result, ANGPTL2 represents a promising target for novel therapies aiming to combat metabolic syndromes, providing a compelling area for further investigation in both basic research and clinical applications.











