Cat: IPD-X12827

Recombinant Human ANGPTL2/Angiopoietin-like 2 Protein(HEK293), N-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ANGPTL2/Angiopoietin-like 2

  • 简介

    ANGPTL2/angiopoietin-like 2 protein takes center stage as it induces endothelial cell sprouting through dual autocrine and paracrine mechanisms. This ability underscores its critical role in angiogenesis, where balanced signaling events control the formation of new blood vessels. ANGPTL2/Angiopoietin-like 2 Protein, Human (HEK293, His) is the recombinant human-derived ANGPTL2/Angiopoietin-like 2 protein, expressed by HEK293 , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human ANGPTL2 at 1 μg/mL (100 μL/well) can bind Recombinant Human ILT4. The ED50 for this effect is 20.45 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human ANGPTL2 at 1 μg/mL (100 μL/well) can bind Recombinant Human ILT4. The ED50 for this effect is 20.45 ng/mL.

  • Alternative Names

    Angiopoietin-related protein 2; ANGPTL2; ANGRP2; ARP2HARP; MGC8889

  • Species

    Human

  • Source

    HEK293

  • Tag

    N-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    Q9UKU9-1

  • Expression Region

    D245-H493

  • AA Sequence

    DQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH

  • Protein Length

    Partial

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ANGPTL2, or angiopoietin-like protein 2, is a member of the angiopoietin-like family, which plays a crucial role in various physiological and pathological processes, including metabolism, inflammation, and cardiovascular diseases. It is primarily secreted by adipose tissue and has been implicated in metabolic disorders such as obesity and insulin resistance. Elevated levels of ANGPTL2 in the bloodstream correlate with adverse metabolic outcomes and inflammatory responses, making it a potential biomarker for conditions like type 2 diabetes and cardiovascular diseases. Research on recombinant ANGPTL2 protein has focused on elucidating its biological functions and mechanisms of action, providing insights into its role in cellular signaling and the regulation of energy homeostasis. Investigating the effects of ANGPTL2 not only contributes to our understanding of metabolic disease pathogenesis but also offers potential therapeutic avenues for targeting this molecule in the treatment of obesity-related disorders. The development of recombinant ANGPTL2 proteins has enabled various experimental studies, including the assessment of its impact on cell proliferation, migration, and inflammation, which are critical for developing strategies to modulate its activity in metabolic diseases. This research advances the understanding of the interconnectedness between ANGPTL2 and key metabolic pathways, highlighting its relevance in therapeutic contexts. As a result, ANGPTL2 represents a promising target for novel therapies aiming to combat metabolic syndromes, providing a compelling area for further investigation in both basic research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US