Cat: PA1000-3898

Recombinant Human COL18A1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    COL18A1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    COL18A1;Collagen alpha-1(XVIII) chain

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P39060

  • Expression Region

    1578-1754aa

  • AA Sequence

    QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQD LYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGK DVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGR LLGQSAASCHHAYIVLCIENSFMTASK

  • Molecular Weight

    21 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

COL18A1, a member of the collagen family, encodes a protein that is crucial for the structural integrity of the extracellular matrix (ECM). It plays a significant role in various biological processes, including tissue repair, angiogenesis, and tumorigenesis. Abnormal expression or mutations in COL18A1 have been linked to several pathological conditions, particularly in the context of cancer, where it can influence tumor growth and metastasis by modulating ECM dynamics and cellular interactions. The protein contains specific domains that facilitate its interaction with other ECM components and growth factors, making it a potential therapeutic target. Recent studies have explored the use of recombinant COL18A1 protein to investigate its functions in vitro and in vivo, providing insights into its role in cancer biology and tissue engineering applications. By understanding the mechanisms underlying COL18A1's activity, researchers aim to develop novel strategies for cancer diagnosis and treatment, as well as to harness its properties in regenerative medicine. Thus, ongoing research into COL18A1 recombinant protein is crucial for elucidating its functions and therapeutic potential in both oncological and developmental contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US