Analytical Data
-
Gene name
COL18A1
- Application
-
Alternative Names
COL18A1；Collagen alpha-1(XVIII) chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P39060
-
Expression Region
1578-1754aa
-
AA Sequence
QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQD LYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGK DVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGR LLGQSAASCHHAYIVLCIENSFMTASK
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COL18A1, a member of the collagen family, encodes a protein that is crucial for the structural integrity of the extracellular matrix (ECM). It plays a significant role in various biological processes, including tissue repair, angiogenesis, and tumorigenesis. Abnormal expression or mutations in COL18A1 have been linked to several pathological conditions, particularly in the context of cancer, where it can influence tumor growth and metastasis by modulating ECM dynamics and cellular interactions. The protein contains specific domains that facilitate its interaction with other ECM components and growth factors, making it a potential therapeutic target. Recent studies have explored the use of recombinant COL18A1 protein to investigate its functions in vitro and in vivo, providing insights into its role in cancer biology and tissue engineering applications. By understanding the mechanisms underlying COL18A1's activity, researchers aim to develop novel strategies for cancer diagnosis and treatment, as well as to harness its properties in regenerative medicine. Thus, ongoing research into COL18A1 recombinant protein is crucial for elucidating its functions and therapeutic potential in both oncological and developmental contexts.
