Cat: PA1000-3824

Recombinant Human TREML2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TREML2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TREML2;C6orf76;Trem-like transcript 2 Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5T2D2

  • Expression Region

    19-268aa

  • AA Sequence

    GPSADSVYTKVRLLEGETLSVQCSYKGYKNRVEGKVWCKIRKKKCEPGFA RVWVKGPRYLLQDDAQAKVVNITMVALKLQDSGRYWCMRNTSGILYPLMG FQLDVSPAPQSERNIPFTHLDNILKSGTVTTGQAPTSGPDAPFTTGVMVF TPGLITLPRLLASTRPASKTGYSFTATSTTSQGPRRTMGSQTVTASPSNA RDSSAGPESISTKSGDLSTRSPTTGLCLTSRSLLNRLPSMPSIRHQDVYS VDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRE EMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

  • Molecular Weight

    54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TREML2 (TREM-like transcript 2) is a member of the TREM family of proteins, which are implicated in immune regulation and cell signaling. Originally identified in humans, TREML2 exhibits a unique expression pattern in immune cells, suggesting its potential role in modulating immune responses, particularly in contexts such as inflammation and autoimmune diseases. Research has shown that TREML2 can influence the activation and differentiation of immune cells, thereby potentially affecting disease outcomes. Its structural characteristics, including the presence of an immunoglobulin-like domain, indicate its involvement in receptor-ligand interactions. The study of TREML2 recombinant proteins has gained attention as a tool to unravel the functional mechanisms of TREML2 in immune modulation. By producing TREML2 as a recombinant protein, researchers can investigate its binding affinities, signaling pathways, and interactions with various ligands and receptors. This knowledge can enhance our understanding of its role in pathophysiological settings, paving the way for therapeutic applications in diseases where TREML2 is dysregulated. Moreover, the exploration of TREML2 in different biological contexts may provide insights into novel immune therapeutic strategies and biomarker developments, contributing significantly to the advancement of immunology and precision medicine. Through the systematic study of TREML2 recombinant proteins, researchers aim to elucidate the complexities of immune regulation and develop interventions targeting this intriguing protein for better health outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US