Analytical Data
-
Gene name
OXA1L
- Application
-
Alternative Names
OXA1L; Mitochondrial inner membrane protein OXA1L; Hsa; OXA1Hs; Oxidase assembly 1-like protein; OXA1-like protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15070
-
Expression Region
1-113 aa
-
AA Sequence
MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCRPHYLFLAASG PRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAE
-
Molecular Weight
48.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
OXA1L, or Oxa1-like protein, is a crucial component of mitochondrial protein synthesis, playing a significant role in the insertion of peptides into the inner mitochondrial membrane. It is involved in the biogenesis and maintenance of the mitochondrial respiratory chain complexes, which are essential for ATP production through oxidative phosphorylation. Mutations or dysfunctions in OXA1L have been associated with various mitochondrial diseases, highlighting its importance in cellular energy metabolism and human health. Research on OXA1L recombinant proteins has gained traction as scientists aim to elucidate its structural and functional properties. Studying these recombinant proteins can provide insights into the mechanisms of mitochondrial translation and assembly, potentially leading to therapeutic strategies for mitochondrial disorders. Furthermore, understanding OXA1L's interactions with other mitochondrial factors may reveal intricate regulatory networks within the mitochondria, contributing to a broader knowledge of mitochondrial dynamics and their implications in aging and neurodegenerative diseases. The exploration of OXA1L recombinant protein not only enhances our fundamental understanding of mitochondrial biology but also offers a promising avenue for developing novel interventions to combat related diseases.
