Cat: IPD-X12662

Recombinant Canine IGFBP-1 Protein(HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IGFBP-1

  • 简介

    IGFBP-1 Protein is a member of the insulin-like growth factor binding protein (IGFBP) family that binds insulin-like growth factor (IGFs) I and II to extend the half-life of IGFs. IGFBP-1 inhibits proliferation, invasion, migration and apoptosis of HTR-8/SVneo cells by inducing MMP-26 expression. IGFBP1 may be a new prognostic factor and a target of molecular targeted therapy for gastric cancer. IGFBP-1 Protein, Canine (HEK293, His) is the recombinant canine-derived IGFBP-1 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to inhibit the biological activity of IGF-I on MCF 7 human breast cancer cells. The ED 50 this effect is 0.5299 µg/mL, corresponding to a specific activity is 1.887×103 U/mg. Measured by its ability to inhibit the biological activity of IGF-I on MCF 7 human breast cancer cells. The ED50 this effect is 0.5299 µg/mL, corresponding to a specific activity is 1.887×103 U/mg.

  • Alternative Names

    Insulin-like growth factor-binding protein 1; PP12; IBP-1;

  • Species

    Canine

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    A0A8I3NJH1

  • Expression Region

    T26-S249

  • AA Sequence

    TPQPWHCAPCTPEKLALCPPVPASCAETALPAGCGCCPMCALPQDAPCGVATARCATGLSCRAAPGEERPLHALIRGRGVCVPTDPAADAKESSESSEITQEQLLENFHLMVPSEEDTPILWNAVRNYKTVRSDDSDKLKEPCRRELHEVLARLAEEQASRQLYSFYLPNCNKNGFYHSRQCKTAMDGQRGLCWCVYPWNGERIPGSVEVRGDPNCGQYFTGHS

  • Protein Length

    Partial

  • Molecular Weight

    25-30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Insulin-like growth factor binding protein-1 (IGFBP-1) is a key regulatory protein that modulates the effects of insulin-like growth factors (IGFs) in various physiological processes, including cell growth, development, and metabolism. Research has shown that IGFBP-1 plays a significant role in the fetal and postnatal growth stages, influencing developmental outcomes and metabolic health. Altered levels of IGFBP-1 have been associated with several pathological conditions, such as diabetes, obesity, and certain cancers, making it a potential biomarker for these diseases. The recombinant production of IGFBP-1 has gained attention in recent years due to its potential applications in therapeutic and diagnostic settings. By utilizing recombinant DNA technology, researchers can produce IGFBP-1 in sufficient quantities for in vitro and in vivo studies, allowing for a deeper understanding of its biological functions and interactions with IGFs. This research supports the exploration of IGFBP-1 as a therapeutic target, as well as its utility in evaluating disease states related to growth and metabolism. Moreover, the study of IGFBP-1 can provide insights into the mechanisms of growth regulation and hormone action, which are vital for developing novel treatment strategies and improving patient outcomes in metabolic and growth-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US