Analytical Data
-
Gene name
SIRT6
- Application
-
Alternative Names
SIRT6;SIR2L6;NAD-dependent Protein deacylase sirtuin-6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N6T7
-
Expression Region
23-288aa
-
AA Sequence
IFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWT MEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRS GFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKAR GLRACRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRH ADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEP KEESPTRINGSIPAGP
-
Molecular Weight
39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SIRT6, a member of the sirtuin family of proteins, is a NAD+-dependent deacetylase that plays a pivotal role in cellular functions such as DNA repair, metabolism, and aging. Research has revealed that SIRT6 is crucial for maintaining genomic integrity, as it directly deacetylates several key proteins involved in DNA damage response and repair pathways. Additionally, SIRT6 influences metabolic processes, including glucose homeostasis and lipid metabolism, thereby linking it to metabolic disorders such as obesity and diabetes. The exploration of SIRT6's role in aging has garnered significant attention, as its activation is associated with increased lifespan and enhanced healthspan in various model organisms. Given its multifaceted functions, SIRT6 has emerged as a promising target for therapeutic interventions aimed at age-related diseases and metabolic syndromes. The production and study of recombinant SIRT6 protein allow researchers to investigate its biochemical properties, interaction partners, and functional mechanisms, providing insights into its potential as a drug target for preventing or treating diseases associated with aging and metabolism. This burgeoning area of research underscores the importance of SIRT6 in both fundamental biology and clinical applications, making it a significant focus for scientists aiming to develop novel strategies for promoting health in an aging population.
