Cat: IPD-X10209

Recombinant Human IL-6RA Protein (HEK293), C-Avi;C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-6RA

  • 简介

    IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha/CD126, Human consists of 468 amino acids (M1-R468) with two fibronectin type-III-like domains contained in the N-terminal part (113-217 a.a, 218-316 a.a), and a soluble form (1-365 a.a). Soluble IL-6R (sIL-6R) binds IL-6 and dimerized gp130 to achieve trans signaling, and exhibits a tissue expression property in some immune systems. IL-6R alpha Protein, Human (L20-P365) is soluble and biotinylated recombinant protein expressed by HEK293 cells with a C-Terminal Avi-tag and a C-Terminal His-tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Interleukin-6 receptor subunit alpha; IL-6R subunit alpha; IL-6R-alpha; IL-6R 1; Membrane glycoprotein 80; gp80; CD126

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-Avi;C-6*His

  • Purity

    > 90% as determined by SDS-PAGE.

  • Uniprot

    P08887

  • Expression Region

    L20-P365

  • AA Sequence

    LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    65-85 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-6 receptor alpha (IL-6RA) plays a pivotal role in the IL-6 signaling pathway, which is crucial for various physiological and pathological processes, including inflammation, immune response, and hematopoiesis. Elevated levels of IL-6 and its receptor have been implicated in several diseases, particularly autoimmune disorders, chronic inflammatory conditions, and even cancers. Consequently, IL-6RA has garnered significant attention as a therapeutic target for drug development. The research into recombinant IL-6RA proteins serves multiple purposes: they can be utilized in basic science to elucidate IL-6 signal transduction mechanisms, to develop novel therapeutic agents or as biomarkers for disease progression and treatment response. Additionally, recombinant IL-6RA proteins can be employed in preclinical and clinical studies to explore their potential in modulating the inflammatory response. By inhibiting IL-6 signaling, these engineered proteins may provide relief in patients with hyper-inflammatory conditions. Given the growing understanding of the role of IL-6 and its receptor in various diseases, research into IL-6RA recombinant proteins not only contributes to a deeper understanding of its biological function but also heralds advances in therapeutic strategies aimed at mitigating the detrimental effects of excessive IL-6 signaling. This research has broad implications for the treatment of diverse conditions, including rheumatoid arthritis, psoriasis, and other chronic inflammatory disorders, making it a highly relevant area within the fields of immunology and pharmacology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US