Cat: IPD-X12558

Recombinant Human EphB2 Protein(Baculovirus), N-His;N-GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EphB2

  • 简介

    EphB2 protein is a receptor tyrosine kinase that participates in bidirectional signaling with the transmembrane ephrin B ligand. It guides commissural axons in the developing cerebral cortex, efferent growth cones of the inner ear, and retinal ganglion cell axons. EphB2 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EPHB2; Ephrin type-B receptor 2; EK5; DRT; EPHT3; ERK; HEK5; TYRO5

  • Species

    Human

  • Source

    Baculovirus

  • Tag

    N-His;N-GST

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P29323-3

  • Expression Region

    G570-V987

  • AA Sequence

    GFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

  • Protein Length

    Partial

  • Molecular Weight

    65 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EphB2 is a member of the Eph receptor tyrosine kinase family, which plays a crucial role in various biological processes, including cell signaling, tissue development, and neural network formation. Dysregulation of EphB2 has been implicated in several pathological conditions, particularly in cancer, where it can influence tumor growth, metastasis, and the tumor microenvironment. This makes EphB2 a compelling target for therapeutic interventions. Research on recombinant EphB2 proteins has gained traction as a means of understanding the precise mechanisms by which EphB2 interacts with its ligands, primarily ephrins, and mediates cellular responses. By studying the structure and functional characteristics of EphB2 in a recombinant form, scientists can elucidate the signaling pathways involved and identify potential biomarkers for cancer diagnosis and prognosis. Furthermore, the production of recombinant EphB2 offers opportunities for drug design and targeted therapies that could modulate its activity, providing avenues for innovative cancer treatments. Understanding the EPHB2-ephrins interaction at the molecular level may also lead to insights into more complex physiological processes, including angiogenesis and neurogenesis, thereby expanding the significance of this receptor beyond oncology. Overall, the ongoing research on recombinant EphB2 proteins not only enhances our foundational knowledge of cellular communication but also holds promise for the development of novel therapeutic strategies against cancer and other diseases associated with EphB2 dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US