Analytical Data
-
Gene name
TEC
- Application
-
Alternative Names
TEC；PSCTK4；Tyrosine-Protein kinase Tec
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42680
-
Expression Region
1-631aa
-
AA Sequence
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLRCWQEKPEGRPSFEDLLRTIDELVECEETFGR
-
Molecular Weight
103 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TEC (T Cell-Receptor-Associated Protein) recombinant proteins have emerged as a critical area of study in immunology and biotechnology due to their vital roles in T cell signaling and immune response. TEC family proteins, including TEC, BTK, and ITK, are non-receptor tyrosine kinases that play essential roles in various cellular processes such as proliferation, differentiation, and survival of immune cells. The understanding of how these proteins function at a molecular level is crucial for developing targeted therapies for immune-related diseases, including autoimmune disorders and cancers. With advancements in recombinant DNA technology, researchers have successfully produced TEC recombinant proteins, facilitating in-depth studies of their structure, function, and interaction with other cellular components. These studies not only enhance our understanding of T cell biology but also pave the way for novel therapeutic strategies, including monoclonal antibodies and small-molecule inhibitors that can modulate T cell activity in disease contexts. The potential applications of TEC recombinant proteins extend beyond immunotherapy, as they also hold promise in vaccine development and personalized medicine approaches. As a result, ongoing research in this field is aimed at elucidating the precise mechanisms through which TEC family proteins influence immune system dynamics, hopefully leading to breakthroughs in treating complex diseases influenced by immune dysfunction.
