Analytical Data
-
Gene name
EphA7
-
简介
The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin A ligands (such as EFNA5). It affects brain development by regulating cell-cell adhesion and repulsion. EphA7 Protein, Rat (HEK293, His) is the recombinant rat-derived EphA7 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Rat EphA7 is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant mouse Ephrin-A4. The ED50 for this effect is 212.3 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Rat EphA7 is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant mouse Ephrin-A4. The ED50 for this effect is 212.3ng/mL.
-
Alternative Names
Ephrin Type-A Receptor 7; EPH Homology Kinase 3; EHK-3; EPH-Like Kinase 11; EK11; EPHA7; HEK11
-
Species
Rat
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
P54759-1
-
Expression Region
Q28-S539
-
AA Sequence
QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEAS
-
Protein Length
Partial
-
Molecular Weight
65-72 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EphA7, a member of the Eph receptor tyrosine kinase family, has garnered significant attention due to its vital roles in various biological processes, including cell adhesion, migration, and neural development. As an important player in the signaling pathways that regulate these functions, EphA7 contributes to the establishment of neuronal networks and plays a critical role in the guidance of axons and dendrites. Additionally, aberrations in EphA7 signaling have been implicated in several pathological conditions, such as cancer progression and neurodegenerative diseases. Due to its complex involvement in both normal physiology and disease states, research into recombinant EphA7 protein has become prominent, focusing on its structure-function relationships, ligand interactions, and downstream signaling mechanisms. By producing and characterizing recombinant EphA7, researchers aim to elucidate its specific roles in cellular processes and its potential as a therapeutic target. Studies utilizing recombinant proteins enable the investigation of EphA7’s interactions with various Ephrin ligands, which is crucial for understanding the modulation of signaling pathways that can affect development and disease. Furthermore, the recombinant forms of EphA7 can be employed in high-throughput screening assays to identify novel small molecules or antibodies that might modulate its activity, thereby paving the way for innovative therapeutic approaches. The ongoing research into EphA7 not only enhances our understanding of fundamental biological mechanisms but also holds promise for the development of targeted interventions in EphA7-related pathologies, positioning it as a key focus in molecular and cellular biology.
