Analytical Data
-
Gene name
GFUS
- Application
-
Alternative Names
GFUS；SDR4E1；TSTA3；GDP-L-fucose synthase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13630
-
Expression Region
1-321aa
-
AA Sequence
MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK
-
Molecular Weight
40.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GFUS (Growth Factor Upregulated in Skeletal Muscle) is a protein that has garnered significant interest in the field of molecular biology and regenerative medicine due to its role in muscle development and repair. Research into GFUS emerged from the need to understand the mechanisms underlying muscle hypertrophy and regeneration, particularly in the context of muscle-wasting diseases, aging, and injury. GFUS is believed to be upregulated in response to growth factors, suggesting that it plays a crucial role in mediating cellular responses to environmental cues, potentially influencing myogenesis and muscle homeostasis. Studies have indicated that GFUS impacts various signaling pathways involved in muscle cell differentiation and proliferation, making it a promising target for therapeutic interventions aimed at enhancing muscle repair and function. Furthermore, the investigation of GFUS has extended to its potential roles in metabolic regulation and systemic health, linking muscle mass to overall physiological well-being. The ongoing research efforts focus on the characterization of GFUS interactions and its functional implications in muscle tissue, thereby paving the way for innovative strategies to combat muscle degeneration and promote muscle health across different age groups and clinical conditions.
