Analytical Data
-
Gene name
LRRC55
- Application
-
Alternative Names
LRRC55; Leucine-rich repeat-containing protein 55; BK channel auxiliary gamma subunit LRRC55
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZSA7
-
Expression Region
1-341aa
-
AA Sequence
MLRSPTFTDAGPRCSCLPVSQTLDSMDTVLMGSLQHCCCLLPKMGDTWAQLPWPGPPHPAMLLISLLLAAGLMHSDAGTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVLDLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVATNFLLGITANCCHRWSKASEEEEI
-
Molecular Weight
64 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LRRC55 (Leucine-rich repeat-containing protein 55) is a member of the leucine-rich repeat (LRR) protein family, which plays crucial roles in various biological processes, including immune responses, cellular signaling, and developmental regulation. This protein is characterized by a series of LRR motifs, which are involved in protein-protein interactions, suggesting its potential significance in modulating cellular functions. Recent studies have indicated that LRRC55 may be implicated in inflammatory processes and immune regulation, making it a candidate for understanding autoimmune diseases and related disorders. Despite its potential importance, the exact biological function and mechanisms of action of LRRC55 remain largely unexplored. The recombinant expression of LRRC55 protein allows for detailed structural and functional analyses, facilitating investigations into its role in cellular pathways and interactions with other proteins. Understanding LRRC55's function could not only elucidate its contribution to normal physiological processes but also provide insights into its involvement in pathological conditions and potential therapeutic applications. Thus, research on LRRC55 recombinant protein is vital for advancing our knowledge in cell biology and immunology.
